3OT9A

Phosphopentomutase from bacillus cereus bound to glucose-1,6-bisphosphate
Slipknot S +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 7-326 320 1-6 343-391 327-342 6 49 slipknot
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDTMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 5-327 323 1-4 332-391 328-331 4 60 slipknot
view details
2.1 6-331 326 1-5 339-391 332-338 5 53 slipknot
view details
2.1 5-341 337 1-4 345-391 342-344 4 47 slipknot
sequence length 391
structure length 391
publication title Bacillus cereus Phosphopentomutase Is an Alkaline Phosphatase Family Member That Exhibits an Altered Entry Point into the Catalytic Cycle.
pubmed doi rcsb
molecule tags Isomerase
molecule keywords Phosphopentomutase
source organism Bacillus cereus
total genus Genus: 141
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2010-09-10
KnotProt deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 3ot9A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3ot9A01
1ALJA 1ALIA 3SZZA 3MK0A 1O99A 1URBA 2GLQA 3BDFA 3M8YA 1ZEFA 3IGZB 1E2SP 3TWZA 1ANJA 1KH4A 3UN5A 3TX0A 1E3CP 1EQJA 1EW9A 1ZEDA 3CMRA 3SZYA 3M7VA 1EW2A 2QZUA 1E1ZP 1K7HA 1AJAA 3BDGA 2GA3A 3BDGB 1N2KA 3DPCA 3UO0A 3MK2A 1HQAA 3NVLA 1SHQA 1N2LA 2G9YA 3M8ZA 1FSUA 1ELYA 2ANHA 4FDIA 1URAA 1EJJA 3BDHA 3MK1A 1AUKA 1KHJA 1ELZA 1AJCA 1Y6VA 3M8WA 1AJBA 3T01A 1KH7A 1SHNA 1KHLA 1O98A 1ED8A 3T02A 1HJKA 1ALKA 1Y7AA 1KH5A 1KHKA 1AJDA 1ANIA 4FDJA 1ZEBA 2IFYA 3ED4A 1ELXA 1E33P 3UNYA 3OT9A 3UN2A 1ED9A 1HDHA 3T00A 1KH9A 3DYCA 3UN3A 1EI6A 1KHNA 3IGYB 1P49A 1B8JA 1EW8A
chains in the KnotProt database with same CATH superfamily
1ALJA 3D7SD 1ALIA 3SZZA 3MK0A 1O99A 1URBA 2GLQA 3BDFA 3M8YA 1ZEFA 3IGZB 1E2SP 3TWZA 1ANJA 1KH4A 3UN5A 3TX0A 1E3CP 1EQJA 1EW9A 1ZEDA 3CMRA 3SZYA 3M7VA 1EW2A 2QZUA 1E1ZP 1K7HA 1AJAA 3BDGA 2GA3A 3BDGB 1N2KA 3DPCA 3UO0A 3MK2A 1HQAA 3NVLA 1SHQA 1N2LA 2G9YA 3M8ZA 1FSUA 1ELYA 2ANHA 4FDIA 1URAA 1EJJA 3BDHA 3MK1A 1AUKA 1KHJA 1ELZA 1AJCA 1Y6VA 3D7SB 3M8WA 1AJBA 3T01A 1KH7A 1SHNA 1KHLA 1O98A 1ED8A 3T02A 1HJKA 1ALKA 1Y7AA 1KH5A 1KHKA 1AJDA 1ANIA 4FDJA 1ZEBA 2IFYA 3ED4A 1ELXA 1E33P 3UNYA 3OT9A 3UN2A 1ED9A 1HDHA 3T00A 1KH9A 3DYCA 3UN3A 1EI6A 1KHNA 3IGYB 1P49A 1B8JA 1EW8A
chains in the KnotProt database with same CATH topology
1ALJA 1ALIA 3SZZA 3MK0A 1O99A 1URBA 2GLQA 3BDFA 3M8YA 1ZEFA 3IGZB 1E2SP 3TWZA 1ANJA 1KH4A 3UN5A 3TX0A 1E3CP 1EQJA 1EW9A 1ZEDA 3CMRA 3SZYA 3M7VA 1EW2A 2QZUA 1E1ZP 1K7HA 1AJAA 3BDGA 2GA3A 3BDGB 1N2KA 3DPCA 3UO0A 3MK2A 1HQAA 3NVLA 1SHQA 1N2LA 2G9YA 3M8ZA 1FSUA 1ELYA 2ANHA 4FDIA 1URAA 1EJJA 3BDHA 3MK1A 1AUKA 1KHJA 1ELZA 1AJCA 1Y6VA 3M8WA 1AJBA 3T01A 1KH7A 1SHNA 1KHLA 1O98A 1ED8A 3T02A 1HJKA 1ALKA 1Y7AA 1KH5A 1KHKA 1AJDA 1ANIA 4FDJA 1ZEBA 2IFYA 3ED4A 1ELXA 1E33P 3UNYA 3OT9A 3UN2A 1ED9A 1HDHA 3T00A 1KH9A 3DYCA 3UN3A 1EI6A 1KHNA 3IGYB 1P49A 1B8JA 1EW8A
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 1ALJ A;  1ALI A;  3SZZ A;  3MK0 A;  1O99 A;  1URB A;  2GLQ A;  3BDF A;  3M8Y A;  1ZEF A;  3IGZ B;  1E2S P;  3TWZ A;  1ANJ A;  1KH4 A;  3UN5 A;  3TX0 A;  1E3C P;  1EQJ A;  1EW9 A;  1ZED A;  3CMR A;  3SZY A;  3M7V A;  1EW2 A;  2QZU A;  1E1Z P;  1K7H A;  1AJA A;  3BDG A;  2GA3 A;  3BDG B;  1N2K A;  3DPC A;  3UO0 A;  3MK2 A;  1HQA A;  3NVL A;  1SHQ A;  1N2L A;  2G9Y A;  3M8Z A;  1FSU A;  1ELY A;  2ANH A;  4FDI A;  1URA A;  1EJJ A;  3BDH A;  3MK1 A;  1AUK A;  1KHJ A;  1ELZ A;  1AJC A;  1Y6V A;  3M8W A;  1AJB A;  3T01 A;  1KH7 A;  1SHN A;  1KHL A;  1O98 A;  1ED8 A;  3T02 A;  1HJK A;  1ALK A;  1Y7A A;  1KH5 A;  1KHK A;  1AJD A;  1ANI A;  4FDJ A;  1ZEB A;  2IFY A;  3ED4 A;  1ELX A;  1E33 P;  3UNY A;  3OT9 A;  3UN2 A;  1ED9 A;  1HDH A;  3T00 A;  1KH9 A;  3DYC A;  3UN3 A;  1EI6 A;  1KHN A;  3IGY B;  1P49 A;  1B8J A;  1EW8 A; 
#chains in the KnotProt database with same CATH topology
 1ALJ A;  3D7S D;  1ALI A;  3SZZ A;  3MK0 A;  1O99 A;  1URB A;  2GLQ A;  3BDF A;  3M8Y A;  1ZEF A;  3IGZ B;  1E2S P;  3TWZ A;  1ANJ A;  1KH4 A;  3UN5 A;  3TX0 A;  1E3C P;  1EQJ A;  1EW9 A;  1ZED A;  3CMR A;  3SZY A;  3M7V A;  1EW2 A;  2QZU A;  1E1Z P;  1K7H A;  1AJA A;  3BDG A;  2GA3 A;  3BDG B;  1N2K A;  3DPC A;  3UO0 A;  3MK2 A;  1HQA A;  3NVL A;  1SHQ A;  1N2L A;  2G9Y A;  3M8Z A;  1FSU A;  1ELY A;  2ANH A;  4FDI A;  1URA A;  1EJJ A;  3BDH A;  3MK1 A;  1AUK A;  1KHJ A;  1ELZ A;  1AJC A;  1Y6V A;  3D7S B;  3M8W A;  1AJB A;  3T01 A;  1KH7 A;  1SHN A;  1KHL A;  1O98 A;  1ED8 A;  3T02 A;  1HJK A;  1ALK A;  1Y7A A;  1KH5 A;  1KHK A;  1AJD A;  1ANI A;  4FDJ A;  1ZEB A;  2IFY A;  3ED4 A;  1ELX A;  1E33 P;  3UNY A;  3OT9 A;  3UN2 A;  1ED9 A;  1HDH A;  3T00 A;  1KH9 A;  3DYC A;  3UN3 A;  1EI6 A;  1KHN A;  3IGY B;  1P49 A;  1B8J A;  1EW8 A; 
#chains in the KnotProt database with same CATH homology
 1ALJ A;  1ALI A;  3SZZ A;  3MK0 A;  1O99 A;  1URB A;  2GLQ A;  3BDF A;  3M8Y A;  1ZEF A;  3IGZ B;  1E2S P;  3TWZ A;  1ANJ A;  1KH4 A;  3UN5 A;  3TX0 A;  1E3C P;  1EQJ A;  1EW9 A;  1ZED A;  3CMR A;  3SZY A;  3M7V A;  1EW2 A;  2QZU A;  1E1Z P;  1K7H A;  1AJA A;  3BDG A;  2GA3 A;  3BDG B;  1N2K A;  3DPC A;  3UO0 A;  3MK2 A;  1HQA A;  3NVL A;  1SHQ A;  1N2L A;  2G9Y A;  3M8Z A;  1FSU A;  1ELY A;  2ANH A;  4FDI A;  1URA A;  1EJJ A;  3BDH A;  3MK1 A;  1AUK A;  1KHJ A;  1ELZ A;  1AJC A;  1Y6V A;  3M8W A;  1AJB A;  3T01 A;  1KH7 A;  1SHN A;  1KHL A;  1O98 A;  1ED8 A;  3T02 A;  1HJK A;  1ALK A;  1Y7A A;  1KH5 A;  1KHK A;  1AJD A;  1ANI A;  4FDJ A;  1ZEB A;  2IFY A;  3ED4 A;  1ELX A;  1E33 P;  3UNY A;  3OT9 A;  3UN2 A;  1ED9 A;  1HDH A;  3T00 A;  1KH9 A;  3DYC A;  3UN3 A;  1EI6 A;  1KHN A;  3IGY B;  1P49 A;  1B8J A;  1EW8 A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling