3TX0A

Unphosphorylated bacillus cereus phosphopentomutase in a p212121 crystal form
Slipknot S +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 7-326 320 1-6 343-391 327-342 6 49 slipknot
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDTMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
2.1 4-335 332 1-3 341-391 336-340 3 51 slipknot
view details
2.1 7-327 321 1-3, 334-391 4-6, 328-333 3 58 slipknot
sequence length 391
structure length 391
publication title Molecular Differences between a Mutase and a Phosphatase: Investigations of the Activation Step in Bacillus cereus Phosphopentomutase.
pubmed doi rcsb
molecule tags Isomerase
molecule keywords Phosphopentomutase
source organism Bacillus cereus
total genus Genus: 143
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2011-09-22
KnotProt deposition date 2014-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 3tx0A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3tx0A01
1O99A 1ALJA 1P49A 1URAA 1ED8A 1E3CP 1KHLA 3NVLA 1AJAA 1HJKA 1ANJA 1KHJA 1KH4A 1HQAA 2QZUA 1KH9A 1E2SP 1EW2A 1EQJA 1AUKA 1ELZA 3MK2A 1ALIA 3UN2A 1AJDA 3DYCA 3TX0A 3MK1A 3UN3A 1KH5A 1ZEFA 3T00A 1AJBA 1ED9A 1SHNA 3UN5A 1ZEBA 1FSUA 1E33P 3BDFA 3M8WA 1KHKA 1O98A 3TWZA 1ELYA 1ELXA 1ZEDA 1B8JA 2GLQA 1EI6A 1KH7A 4FDIA 3M8YA 1N2LA 3SZZA 1K7HA 1SHQA 3DPCA 3M8ZA 1EW9A 1Y6VA 3UO0A 2G9YA 1KHNA 3MK0A 4FDJA 2ANHA 3BDGA 3SZYA 3T02A 3IGZB 3BDHA 3IGYB 1E1ZP 3CMRA 1ALKA 1URBA 1HDHA 1AJCA 1ANIA 1EW8A 3M7VA 2IFYA 3ED4A 3UNYA 3OT9A 1N2KA 3BDGB 1EJJA 1Y7AA 3T01A 2GA3A
chains in the KnotProt database with same CATH superfamily
1O99A 1ALJA 1P49A 1URAA 1ED8A 1E3CP 1KHLA 3NVLA 1AJAA 1HJKA 1ANJA 1KHJA 1KH4A 1HQAA 2QZUA 1KH9A 1E2SP 1EW2A 1EQJA 1AUKA 1ELZA 3MK2A 1ALIA 3UN2A 1AJDA 3DYCA 3TX0A 3MK1A 3UN3A 1KH5A 1ZEFA 3T00A 1AJBA 1ED9A 1SHNA 3UN5A 1ZEBA 1FSUA 1E33P 3BDFA 3M8WA 1KHKA 1O98A 3TWZA 1ELYA 1ELXA 1ZEDA 1B8JA 2GLQA 1EI6A 1KH7A 4FDIA 3M8YA 1N2LA 3SZZA 1K7HA 1SHQA 3DPCA 3M8ZA 1EW9A 1Y6VA 3UO0A 2G9YA 1KHNA 3MK0A 4FDJA 2ANHA 3BDGA 3SZYA 3T02A 3D7SD 3IGZB 3BDHA 3IGYB 1E1ZP 3CMRA 1ALKA 1URBA 1HDHA 1AJCA 1ANIA 1EW8A 3M7VA 2IFYA 3ED4A 3UNYA 3D7SB 3OT9A 1N2KA 3BDGB 1EJJA 1Y7AA 3T01A 2GA3A
chains in the KnotProt database with same CATH topology
1O99A 1ALJA 1P49A 1URAA 1ED8A 1E3CP 1KHLA 3NVLA 1AJAA 1HJKA 1ANJA 1KHJA 1KH4A 1HQAA 2QZUA 1KH9A 1E2SP 1EW2A 1EQJA 1AUKA 1ELZA 3MK2A 1ALIA 3UN2A 1AJDA 3DYCA 3TX0A 3MK1A 3UN3A 1KH5A 1ZEFA 3T00A 1AJBA 1ED9A 1SHNA 3UN5A 1ZEBA 1FSUA 1E33P 3BDFA 3M8WA 1KHKA 1O98A 3TWZA 1ELYA 1ELXA 1ZEDA 1B8JA 2GLQA 1EI6A 1KH7A 4FDIA 3M8YA 1N2LA 3SZZA 1K7HA 1SHQA 3DPCA 3M8ZA 1EW9A 1Y6VA 3UO0A 2G9YA 1KHNA 3MK0A 4FDJA 2ANHA 3BDGA 3SZYA 3T02A 3IGZB 3BDHA 3IGYB 1E1ZP 3CMRA 1ALKA 1URBA 1HDHA 1AJCA 1ANIA 1EW8A 3M7VA 2IFYA 3ED4A 3UNYA 3OT9A 1N2KA 3BDGB 1EJJA 1Y7AA 3T01A 2GA3A
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 1O99 A;  1ALJ A;  1P49 A;  1URA A;  1ED8 A;  1E3C P;  1KHL A;  3NVL A;  1AJA A;  1HJK A;  1ANJ A;  1KHJ A;  1KH4 A;  1HQA A;  2QZU A;  1KH9 A;  1E2S P;  1EW2 A;  1EQJ A;  1AUK A;  1ELZ A;  3MK2 A;  1ALI A;  3UN2 A;  1AJD A;  3DYC A;  3TX0 A;  3MK1 A;  3UN3 A;  1KH5 A;  1ZEF A;  3T00 A;  1AJB A;  1ED9 A;  1SHN A;  3UN5 A;  1ZEB A;  1FSU A;  1E33 P;  3BDF A;  3M8W A;  1KHK A;  1O98 A;  3TWZ A;  1ELY A;  1ELX A;  1ZED A;  1B8J A;  2GLQ A;  1EI6 A;  1KH7 A;  4FDI A;  3M8Y A;  1N2L A;  3SZZ A;  1K7H A;  1SHQ A;  3DPC A;  3M8Z A;  1EW9 A;  1Y6V A;  3UO0 A;  2G9Y A;  1KHN A;  3MK0 A;  4FDJ A;  2ANH A;  3BDG A;  3SZY A;  3T02 A;  3IGZ B;  3BDH A;  3IGY B;  1E1Z P;  3CMR A;  1ALK A;  1URB A;  1HDH A;  1AJC A;  1ANI A;  1EW8 A;  3M7V A;  2IFY A;  3ED4 A;  3UNY A;  3OT9 A;  1N2K A;  3BDG B;  1EJJ A;  1Y7A A;  3T01 A;  2GA3 A; 
#chains in the KnotProt database with same CATH topology
 1O99 A;  1ALJ A;  1P49 A;  1URA A;  1ED8 A;  1E3C P;  1KHL A;  3NVL A;  1AJA A;  1HJK A;  1ANJ A;  1KHJ A;  1KH4 A;  1HQA A;  2QZU A;  1KH9 A;  1E2S P;  1EW2 A;  1EQJ A;  1AUK A;  1ELZ A;  3MK2 A;  1ALI A;  3UN2 A;  1AJD A;  3DYC A;  3TX0 A;  3MK1 A;  3UN3 A;  1KH5 A;  1ZEF A;  3T00 A;  1AJB A;  1ED9 A;  1SHN A;  3UN5 A;  1ZEB A;  1FSU A;  1E33 P;  3BDF A;  3M8W A;  1KHK A;  1O98 A;  3TWZ A;  1ELY A;  1ELX A;  1ZED A;  1B8J A;  2GLQ A;  1EI6 A;  1KH7 A;  4FDI A;  3M8Y A;  1N2L A;  3SZZ A;  1K7H A;  1SHQ A;  3DPC A;  3M8Z A;  1EW9 A;  1Y6V A;  3UO0 A;  2G9Y A;  1KHN A;  3MK0 A;  4FDJ A;  2ANH A;  3BDG A;  3SZY A;  3T02 A;  3D7S D;  3IGZ B;  3BDH A;  3IGY B;  1E1Z P;  3CMR A;  1ALK A;  1URB A;  1HDH A;  1AJC A;  1ANI A;  1EW8 A;  3M7V A;  2IFY A;  3ED4 A;  3UNY A;  3D7S B;  3OT9 A;  1N2K A;  3BDG B;  1EJJ A;  1Y7A A;  3T01 A;  2GA3 A; 
#chains in the KnotProt database with same CATH homology
 1O99 A;  1ALJ A;  1P49 A;  1URA A;  1ED8 A;  1E3C P;  1KHL A;  3NVL A;  1AJA A;  1HJK A;  1ANJ A;  1KHJ A;  1KH4 A;  1HQA A;  2QZU A;  1KH9 A;  1E2S P;  1EW2 A;  1EQJ A;  1AUK A;  1ELZ A;  3MK2 A;  1ALI A;  3UN2 A;  1AJD A;  3DYC A;  3TX0 A;  3MK1 A;  3UN3 A;  1KH5 A;  1ZEF A;  3T00 A;  1AJB A;  1ED9 A;  1SHN A;  3UN5 A;  1ZEB A;  1FSU A;  1E33 P;  3BDF A;  3M8W A;  1KHK A;  1O98 A;  3TWZ A;  1ELY A;  1ELX A;  1ZED A;  1B8J A;  2GLQ A;  1EI6 A;  1KH7 A;  4FDI A;  3M8Y A;  1N2L A;  3SZZ A;  1K7H A;  1SHQ A;  3DPC A;  3M8Z A;  1EW9 A;  1Y6V A;  3UO0 A;  2G9Y A;  1KHN A;  3MK0 A;  4FDJ A;  2ANH A;  3BDG A;  3SZY A;  3T02 A;  3IGZ B;  3BDH A;  3IGY B;  1E1Z P;  3CMR A;  1ALK A;  1URB A;  1HDH A;  1AJC A;  1ANI A;  1EW8 A;  3M7V A;  2IFY A;  3ED4 A;  3UNY A;  3OT9 A;  1N2K A;  3BDG B;  1EJJ A;  1Y7A A;  3T01 A;  2GA3 A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling