3TX0A

Unphosphorylated bacillus cereus phosphopentomutase in a p212121 crystal form
Slipknot S +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 7-326 320 1-6 343-391 327-342 6 49 slipknot
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDTMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
2.1 4-335 332 1-3 341-391 336-340 3 51 slipknot
view details
2.1 7-327 321 1-3, 334-391 4-6, 328-333 3 58 slipknot
sequence length 391
structure length 391
publication title Molecular Differences between a Mutase and a Phosphatase: Investigations of the Activation Step in Bacillus cereus Phosphopentomutase.
pubmed doi rcsb
molecule tags Isomerase
molecule keywords Phosphopentomutase
source organism Bacillus cereus
total genus Genus: 143
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2011-09-22
KnotProt deposition date 2014-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 3tx0A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3tx0A01
3MK0A 1EJJA 4FDJA 1KH4A 2QZUA 1Y6VA 3OT9A 1URBA 3NVLA 3ED4A 1ED9A 1ELZA 1Y7AA 3UN5A 3UN2A 3CMRA 1KHJA 1EQJA 1KH9A 1ZEDA 3MK2A 3IGYB 1E1ZP 3DYCA 1ELYA 1EW2A 3SZZA 3M8YA 1O99A 1KH7A 1O98A 1HJKA 4FDIA 1ALHA 1KHKA 1B8JA 3UO0A 2GA3A 3BDFA 3M8WA 1EW8A 1N2LA 3DPCA 1AJBA 1ANJA 3T00A 1ALKA 1ALIA 1EW9A 1E2SP 3UN3A 2G9YA 3TWZA 1KHNA 2ANHA 1KH5A 3BDHA 1ALJA 1E33P 1AJDA 3TX0A 1HDHA 1KHLA 3M8ZA 3UNYA 1P49A 3T01A 3BDGA 2IFYA 3M7VA 1E3CP 2GLQA 1ELXA 3IGZB 1ED8A 1AJCA 1SHNA 1N2KA 3MK1A 1EI6A 1ZEFA 1AJAA 1SHQA 3BDGB 3SZYA 1AUKA 1FSUA 1K7HA 1ANIA 1HQAA 1URAA 1ZEBA 3T02A
chains in the KnotProt database with same CATH superfamily
3MK0A 1EJJA 4FDJA 1KH4A 2QZUA 1Y6VA 3OT9A 1URBA 3NVLA 3ED4A 1ED9A 1ELZA 1Y7AA 3UN5A 3UN2A 3CMRA 1KHJA 1EQJA 1KH9A 1ZEDA 3MK2A 3IGYB 1E1ZP 3DYCA 1ELYA 1EW2A 3SZZA 3M8YA 1O99A 1KH7A 1O98A 1HJKA 4FDIA 1ALHA 1KHKA 1B8JA 3UO0A 2GA3A 3BDFA 3M8WA 1EW8A 1N2LA 3DPCA 1AJBA 1ANJA 3T00A 1ALKA 1ALIA 1EW9A 1E2SP 3UN3A 2G9YA 3TWZA 1KHNA 2ANHA 1KH5A 3BDHA 1ALJA 1E33P 1AJDA 3TX0A 1HDHA 1KHLA 3M8ZA 3UNYA 1P49A 3T01A 3BDGA 2IFYA 3D7SD 3M7VA 1E3CP 2GLQA 1ELXA 3D7SB 3IGZB 1ED8A 1AJCA 1SHNA 1N2KA 3MK1A 1EI6A 1ZEFA 1AJAA 1SHQA 3BDGB 3SZYA 1AUKA 1FSUA 1K7HA 1ANIA 1HQAA 1URAA 1ZEBA 3T02A
chains in the KnotProt database with same CATH topology
3MK0A 1EJJA 4FDJA 1KH4A 2QZUA 1Y6VA 3OT9A 1URBA 3NVLA 3ED4A 1ED9A 1ELZA 1Y7AA 3UN5A 3UN2A 3CMRA 1KHJA 1EQJA 1KH9A 1ZEDA 3MK2A 3IGYB 1E1ZP 3DYCA 1ELYA 1EW2A 3SZZA 3M8YA 1O99A 1KH7A 1O98A 1HJKA 4FDIA 1ALHA 1KHKA 1B8JA 3UO0A 2GA3A 3BDFA 3M8WA 1EW8A 1N2LA 3DPCA 1AJBA 1ANJA 3T00A 1ALKA 1ALIA 1EW9A 1E2SP 3UN3A 2G9YA 3TWZA 1KHNA 2ANHA 1KH5A 3BDHA 1ALJA 1E33P 1AJDA 3TX0A 1HDHA 1KHLA 3M8ZA 3UNYA 1P49A 3T01A 3BDGA 2IFYA 3M7VA 1E3CP 2GLQA 1ELXA 3IGZB 1ED8A 1AJCA 1SHNA 1N2KA 3MK1A 1EI6A 1ZEFA 1AJAA 1SHQA 3BDGB 3SZYA 1AUKA 1FSUA 1K7HA 1ANIA 1HQAA 1URAA 1ZEBA 3T02A
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 3MK0 A;  1EJJ A;  4FDJ A;  1KH4 A;  2QZU A;  1Y6V A;  3OT9 A;  1URB A;  3NVL A;  3ED4 A;  1ED9 A;  1ELZ A;  1Y7A A;  3UN5 A;  3UN2 A;  3CMR A;  1KHJ A;  1EQJ A;  1KH9 A;  1ZED A;  3MK2 A;  3IGY B;  1E1Z P;  3DYC A;  1ELY A;  1EW2 A;  3SZZ A;  3M8Y A;  1O99 A;  1KH7 A;  1O98 A;  1HJK A;  4FDI A;  1ALH A;  1KHK A;  1B8J A;  3UO0 A;  2GA3 A;  3BDF A;  3M8W A;  1EW8 A;  1N2L A;  3DPC A;  1AJB A;  1ANJ A;  3T00 A;  1ALK A;  1ALI A;  1EW9 A;  1E2S P;  3UN3 A;  2G9Y A;  3TWZ A;  1KHN A;  2ANH A;  1KH5 A;  3BDH A;  1ALJ A;  1E33 P;  1AJD A;  3TX0 A;  1HDH A;  1KHL A;  3M8Z A;  3UNY A;  1P49 A;  3T01 A;  3BDG A;  2IFY A;  3M7V A;  1E3C P;  2GLQ A;  1ELX A;  3IGZ B;  1ED8 A;  1AJC A;  1SHN A;  1N2K A;  3MK1 A;  1EI6 A;  1ZEF A;  1AJA A;  1SHQ A;  3BDG B;  3SZY A;  1AUK A;  1FSU A;  1K7H A;  1ANI A;  1HQA A;  1URA A;  1ZEB A;  3T02 A; 
#chains in the KnotProt database with same CATH topology
 3MK0 A;  1EJJ A;  4FDJ A;  1KH4 A;  2QZU A;  1Y6V A;  3OT9 A;  1URB A;  3NVL A;  3ED4 A;  1ED9 A;  1ELZ A;  1Y7A A;  3UN5 A;  3UN2 A;  3CMR A;  1KHJ A;  1EQJ A;  1KH9 A;  1ZED A;  3MK2 A;  3IGY B;  1E1Z P;  3DYC A;  1ELY A;  1EW2 A;  3SZZ A;  3M8Y A;  1O99 A;  1KH7 A;  1O98 A;  1HJK A;  4FDI A;  1ALH A;  1KHK A;  1B8J A;  3UO0 A;  2GA3 A;  3BDF A;  3M8W A;  1EW8 A;  1N2L A;  3DPC A;  1AJB A;  1ANJ A;  3T00 A;  1ALK A;  1ALI A;  1EW9 A;  1E2S P;  3UN3 A;  2G9Y A;  3TWZ A;  1KHN A;  2ANH A;  1KH5 A;  3BDH A;  1ALJ A;  1E33 P;  1AJD A;  3TX0 A;  1HDH A;  1KHL A;  3M8Z A;  3UNY A;  1P49 A;  3T01 A;  3BDG A;  2IFY A;  3D7S D;  3M7V A;  1E3C P;  2GLQ A;  1ELX A;  3D7S B;  3IGZ B;  1ED8 A;  1AJC A;  1SHN A;  1N2K A;  3MK1 A;  1EI6 A;  1ZEF A;  1AJA A;  1SHQ A;  3BDG B;  3SZY A;  1AUK A;  1FSU A;  1K7H A;  1ANI A;  1HQA A;  1URA A;  1ZEB A;  3T02 A; 
#chains in the KnotProt database with same CATH homology
 3MK0 A;  1EJJ A;  4FDJ A;  1KH4 A;  2QZU A;  1Y6V A;  3OT9 A;  1URB A;  3NVL A;  3ED4 A;  1ED9 A;  1ELZ A;  1Y7A A;  3UN5 A;  3UN2 A;  3CMR A;  1KHJ A;  1EQJ A;  1KH9 A;  1ZED A;  3MK2 A;  3IGY B;  1E1Z P;  3DYC A;  1ELY A;  1EW2 A;  3SZZ A;  3M8Y A;  1O99 A;  1KH7 A;  1O98 A;  1HJK A;  4FDI A;  1ALH A;  1KHK A;  1B8J A;  3UO0 A;  2GA3 A;  3BDF A;  3M8W A;  1EW8 A;  1N2L A;  3DPC A;  1AJB A;  1ANJ A;  3T00 A;  1ALK A;  1ALI A;  1EW9 A;  1E2S P;  3UN3 A;  2G9Y A;  3TWZ A;  1KHN A;  2ANH A;  1KH5 A;  3BDH A;  1ALJ A;  1E33 P;  1AJD A;  3TX0 A;  1HDH A;  1KHL A;  3M8Z A;  3UNY A;  1P49 A;  3T01 A;  3BDG A;  2IFY A;  3M7V A;  1E3C P;  2GLQ A;  1ELX A;  3IGZ B;  1ED8 A;  1AJC A;  1SHN A;  1N2K A;  3MK1 A;  1EI6 A;  1ZEF A;  1AJA A;  1SHQ A;  3BDG B;  3SZY A;  1AUK A;  1FSU A;  1K7H A;  1ANI A;  1HQA A;  1URA A;  1ZEB A;  3T02 A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling