3UN2A

Phosphopentomutase t85q variant enzyme
Slipknot S +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 7-327 321 1-6 343-391 328-342 6 49 slipknot
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDQMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 6-331 326 1-5 338-391 332-337 5 54 slipknot
view details
2.1 4-340 337 1-3 345-391 341-344 3 47 slipknot
sequence length 391
structure length 391
publication title Molecular Differences between a Mutase and a Phosphatase: Investigations of the Activation Step in Bacillus cereus Phosphopentomutase.
pubmed doi rcsb
molecule tags Isomerase
molecule keywords Phosphopentomutase
source organism Bacillus cereus
total genus Genus: 140
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2011-11-15
KnotProt deposition date 2014-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 3un2A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3un2A01
1KHNA 3ED4A 3M8YA 3IGYB 3OT9A 3M8ZA 1O98A 2QZUA 3T01A 3M8WA 3BDGA 1EW9A 1ZEBA 1KHJA 1ZEFA 1EI6A 2G9YA 1AJAA 3SZYA 1Y6VA 3UO0A 1K7HA 1HJKA 1EW8A 1KH5A 1AJDA 1P49A 1ELYA 1ELXA 3MK1A 1B8JA 2ANHA 3BDGB 4FDJA 3UN2A 1ED9A 1ALIA 1Y7AA 3MK0A 1ED8A 3SZZA 1HQAA 1KH4A 1AJCA 1EW2A 1ZEDA 2IFYA 1EJJA 1ELZA 3MK2A 3NVLA 1ALKA 3DYCA 1AJBA 1N2LA 1E1ZP 3BDFA 3T02A 1ANJA 3T00A 1FSUA 3TWZA 3UN5A 3UNYA 2GA3A 1E3CP 1SHNA 1EQJA 1KH7A 3BDHA 3DPCA 1KH9A 1ANIA 3TX0A 1KHKA 1KHLA 1O99A 1SHQA 1AUKA 1URBA 1E2SP 3CMRA 1ALJA 1URAA 3IGZB 1HDHA 3M7VA 1N2KA 1E33P 2GLQA 3UN3A 4FDIA
chains in the KnotProt database with same CATH superfamily
1KHNA 3ED4A 3M8YA 3IGYB 3OT9A 3M8ZA 1O98A 2QZUA 3T01A 3M8WA 3BDGA 1EW9A 1ZEBA 1KHJA 1ZEFA 1EI6A 2G9YA 1AJAA 3SZYA 1Y6VA 3UO0A 1K7HA 1HJKA 1EW8A 1KH5A 1AJDA 1P49A 1ELYA 1ELXA 3MK1A 1B8JA 2ANHA 3BDGB 4FDJA 3UN2A 1ED9A 1ALIA 1Y7AA 3MK0A 1ED8A 3SZZA 1HQAA 1KH4A 1AJCA 1EW2A 1ZEDA 2IFYA 1EJJA 1ELZA 3MK2A 3NVLA 1ALKA 3DYCA 1AJBA 1N2LA 1E1ZP 3BDFA 3T02A 1ANJA 3T00A 1FSUA 3TWZA 3UN5A 3UNYA 2GA3A 1E3CP 3D7SD 1SHNA 1EQJA 1KH7A 3BDHA 3DPCA 1KH9A 1ANIA 3TX0A 1KHKA 1KHLA 1O99A 1SHQA 1AUKA 1URBA 1E2SP 3CMRA 1ALJA 1URAA 3IGZB 1HDHA 3M7VA 1N2KA 1E33P 2GLQA 3UN3A 3D7SB 4FDIA
chains in the KnotProt database with same CATH topology
1KHNA 3ED4A 3M8YA 3IGYB 3OT9A 3M8ZA 1O98A 2QZUA 3T01A 3M8WA 3BDGA 1EW9A 1ZEBA 1KHJA 1ZEFA 1EI6A 2G9YA 1AJAA 3SZYA 1Y6VA 3UO0A 1K7HA 1HJKA 1EW8A 1KH5A 1AJDA 1P49A 1ELYA 1ELXA 3MK1A 1B8JA 2ANHA 3BDGB 4FDJA 3UN2A 1ED9A 1ALIA 1Y7AA 3MK0A 1ED8A 3SZZA 1HQAA 1KH4A 1AJCA 1EW2A 1ZEDA 2IFYA 1EJJA 1ELZA 3MK2A 3NVLA 1ALKA 3DYCA 1AJBA 1N2LA 1E1ZP 3BDFA 3T02A 1ANJA 3T00A 1FSUA 3TWZA 3UN5A 3UNYA 2GA3A 1E3CP 1SHNA 1EQJA 1KH7A 3BDHA 3DPCA 1KH9A 1ANIA 3TX0A 1KHKA 1KHLA 1O99A 1SHQA 1AUKA 1URBA 1E2SP 3CMRA 1ALJA 1URAA 3IGZB 1HDHA 3M7VA 1N2KA 1E33P 2GLQA 3UN3A 4FDIA
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 1KHN A;  3ED4 A;  3M8Y A;  3IGY B;  3OT9 A;  3M8Z A;  1O98 A;  2QZU A;  3T01 A;  3M8W A;  3BDG A;  1EW9 A;  1ZEB A;  1KHJ A;  1ZEF A;  1EI6 A;  2G9Y A;  1AJA A;  3SZY A;  1Y6V A;  3UO0 A;  1K7H A;  1HJK A;  1EW8 A;  1KH5 A;  1AJD A;  1P49 A;  1ELY A;  1ELX A;  3MK1 A;  1B8J A;  2ANH A;  3BDG B;  4FDJ A;  3UN2 A;  1ED9 A;  1ALI A;  1Y7A A;  3MK0 A;  1ED8 A;  3SZZ A;  1HQA A;  1KH4 A;  1AJC A;  1EW2 A;  1ZED A;  2IFY A;  1EJJ A;  1ELZ A;  3MK2 A;  3NVL A;  1ALK A;  3DYC A;  1AJB A;  1N2L A;  1E1Z P;  3BDF A;  3T02 A;  1ANJ A;  3T00 A;  1FSU A;  3TWZ A;  3UN5 A;  3UNY A;  2GA3 A;  1E3C P;  1SHN A;  1EQJ A;  1KH7 A;  3BDH A;  3DPC A;  1KH9 A;  1ANI A;  3TX0 A;  1KHK A;  1KHL A;  1O99 A;  1SHQ A;  1AUK A;  1URB A;  1E2S P;  3CMR A;  1ALJ A;  1URA A;  3IGZ B;  1HDH A;  3M7V A;  1N2K A;  1E33 P;  2GLQ A;  3UN3 A;  4FDI A; 
#chains in the KnotProt database with same CATH topology
 1KHN A;  3ED4 A;  3M8Y A;  3IGY B;  3OT9 A;  3M8Z A;  1O98 A;  2QZU A;  3T01 A;  3M8W A;  3BDG A;  1EW9 A;  1ZEB A;  1KHJ A;  1ZEF A;  1EI6 A;  2G9Y A;  1AJA A;  3SZY A;  1Y6V A;  3UO0 A;  1K7H A;  1HJK A;  1EW8 A;  1KH5 A;  1AJD A;  1P49 A;  1ELY A;  1ELX A;  3MK1 A;  1B8J A;  2ANH A;  3BDG B;  4FDJ A;  3UN2 A;  1ED9 A;  1ALI A;  1Y7A A;  3MK0 A;  1ED8 A;  3SZZ A;  1HQA A;  1KH4 A;  1AJC A;  1EW2 A;  1ZED A;  2IFY A;  1EJJ A;  1ELZ A;  3MK2 A;  3NVL A;  1ALK A;  3DYC A;  1AJB A;  1N2L A;  1E1Z P;  3BDF A;  3T02 A;  1ANJ A;  3T00 A;  1FSU A;  3TWZ A;  3UN5 A;  3UNY A;  2GA3 A;  1E3C P;  3D7S D;  1SHN A;  1EQJ A;  1KH7 A;  3BDH A;  3DPC A;  1KH9 A;  1ANI A;  3TX0 A;  1KHK A;  1KHL A;  1O99 A;  1SHQ A;  1AUK A;  1URB A;  1E2S P;  3CMR A;  1ALJ A;  1URA A;  3IGZ B;  1HDH A;  3M7V A;  1N2K A;  1E33 P;  2GLQ A;  3UN3 A;  3D7S B;  4FDI A; 
#chains in the KnotProt database with same CATH homology
 1KHN A;  3ED4 A;  3M8Y A;  3IGY B;  3OT9 A;  3M8Z A;  1O98 A;  2QZU A;  3T01 A;  3M8W A;  3BDG A;  1EW9 A;  1ZEB A;  1KHJ A;  1ZEF A;  1EI6 A;  2G9Y A;  1AJA A;  3SZY A;  1Y6V A;  3UO0 A;  1K7H A;  1HJK A;  1EW8 A;  1KH5 A;  1AJD A;  1P49 A;  1ELY A;  1ELX A;  3MK1 A;  1B8J A;  2ANH A;  3BDG B;  4FDJ A;  3UN2 A;  1ED9 A;  1ALI A;  1Y7A A;  3MK0 A;  1ED8 A;  3SZZ A;  1HQA A;  1KH4 A;  1AJC A;  1EW2 A;  1ZED A;  2IFY A;  1EJJ A;  1ELZ A;  3MK2 A;  3NVL A;  1ALK A;  3DYC A;  1AJB A;  1N2L A;  1E1Z P;  3BDF A;  3T02 A;  1ANJ A;  3T00 A;  1FSU A;  3TWZ A;  3UN5 A;  3UNY A;  2GA3 A;  1E3C P;  1SHN A;  1EQJ A;  1KH7 A;  3BDH A;  3DPC A;  1KH9 A;  1ANI A;  3TX0 A;  1KHK A;  1KHL A;  1O99 A;  1SHQ A;  1AUK A;  1URB A;  1E2S P;  3CMR A;  1ALJ A;  1URA A;  3IGZ B;  1HDH A;  3M7V A;  1N2K A;  1E33 P;  2GLQ A;  3UN3 A;  4FDI A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling