3UO0A

Phosphorylated bacillus cereus phosphopentomutase soaked with glucose 1,6-bisphosphate
Slipknot S +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 7-324 318 1-6 343-391 325-342 6 49 slipknot
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDTMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
2.1 6-327 322 1-5 332-391 328-331 5 60 slipknot
view details
3.1 7-329 323 1-6 338-391 330-337 6 54 slipknot
view details
2.1 5-340 336 1-4 345-391 341-344 4 47 slipknot
sequence length 391
structure length 391
publication title Molecular Differences between a Mutase and a Phosphatase: Investigations of the Activation Step in Bacillus cereus Phosphopentomutase.
pubmed doi rcsb
molecule tags Isomerase
molecule keywords Phosphopentomutase
source organism Bacillus cereus
total genus Genus: 138
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2011-11-16
KnotProt deposition date 2014-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 3uo0A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3uo0A01
1AUKA 3T00A 1EI6A 1ZEDA 1EJJA 3SZYA 3DPCA 1URAA 3M8WA 2QZUA 1HJKA 3MK1A 3UN3A 2IFYA 3UNYA 2GLQA 1ELZA 1K7HA 1HQAA 1EW8A 1B8JA 3BDFA 3SZZA 1ALJA 3UN2A 1E2SP 1ELXA 1Y6VA 3CMRA 3UN5A 1E3CP 1KHJA 1ED9A 3BDGA 1AJAA 1N2KA 1ANJA 3T01A 1ALIA 1O98A 3DYCA 1ANIA 1ED8A 3M7VA 1ALKA 1O99A 1AJBA 2GA3A 1KHNA 1FSUA 1AJCA 3BDGB 3IGYB 3T02A 1ZEFA 3M8YA 1SHQA 1KH7A 1KHKA 1KH5A 1ELYA 1ZEBA 1P49A 2G9YA 1E1ZP 2ANHA 1Y7AA 3UO0A 1EW9A 3TX0A 3MK0A 4FDJA 4FDIA 3M8ZA 1KHLA 1KH4A 3OT9A 3IGZB 3MK2A 1N2LA 1HDHA 1SHNA 3TWZA 1E33P 1KH9A 1EW2A 3ED4A 1URBA 1AJDA 3NVLA 1EQJA 3BDHA
chains in the KnotProt database with same CATH superfamily
1AUKA 3T00A 1EI6A 1ZEDA 1EJJA 3SZYA 3DPCA 1URAA 3M8WA 2QZUA 1HJKA 3MK1A 3UN3A 2IFYA 3UNYA 2GLQA 1ELZA 1K7HA 1HQAA 1EW8A 1B8JA 3BDFA 3SZZA 1ALJA 3UN2A 1E2SP 1ELXA 1Y6VA 3CMRA 3UN5A 3D7SD 1E3CP 1KHJA 1ED9A 3BDGA 3D7SB 1AJAA 1N2KA 1ANJA 3T01A 1ALIA 1O98A 3DYCA 1ANIA 1ED8A 3M7VA 1ALKA 1O99A 1AJBA 2GA3A 1KHNA 1FSUA 1AJCA 3BDGB 3IGYB 3T02A 1ZEFA 3M8YA 1SHQA 1KH7A 1KHKA 1KH5A 1ELYA 1ZEBA 1P49A 2G9YA 1E1ZP 2ANHA 1Y7AA 3UO0A 1EW9A 3TX0A 3MK0A 4FDJA 4FDIA 3M8ZA 1KHLA 1KH4A 3OT9A 3IGZB 3MK2A 1N2LA 1HDHA 1SHNA 3TWZA 1E33P 1KH9A 1EW2A 3ED4A 1URBA 1AJDA 3NVLA 1EQJA 3BDHA
chains in the KnotProt database with same CATH topology
1AUKA 3T00A 1EI6A 1ZEDA 1EJJA 3SZYA 3DPCA 1URAA 3M8WA 2QZUA 1HJKA 3MK1A 3UN3A 2IFYA 3UNYA 2GLQA 1ELZA 1K7HA 1HQAA 1EW8A 1B8JA 3BDFA 3SZZA 1ALJA 3UN2A 1E2SP 1ELXA 1Y6VA 3CMRA 3UN5A 1E3CP 1KHJA 1ED9A 3BDGA 1AJAA 1N2KA 1ANJA 3T01A 1ALIA 1O98A 3DYCA 1ANIA 1ED8A 3M7VA 1ALKA 1O99A 1AJBA 2GA3A 1KHNA 1FSUA 1AJCA 3BDGB 3IGYB 3T02A 1ZEFA 3M8YA 1SHQA 1KH7A 1KHKA 1KH5A 1ELYA 1ZEBA 1P49A 2G9YA 1E1ZP 2ANHA 1Y7AA 3UO0A 1EW9A 3TX0A 3MK0A 4FDJA 4FDIA 3M8ZA 1KHLA 1KH4A 3OT9A 3IGZB 3MK2A 1N2LA 1HDHA 1SHNA 3TWZA 1E33P 1KH9A 1EW2A 3ED4A 1URBA 1AJDA 3NVLA 1EQJA 3BDHA
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 1AUK A;  3T00 A;  1EI6 A;  1ZED A;  1EJJ A;  3SZY A;  3DPC A;  1URA A;  3M8W A;  2QZU A;  1HJK A;  3MK1 A;  3UN3 A;  2IFY A;  3UNY A;  2GLQ A;  1ELZ A;  1K7H A;  1HQA A;  1EW8 A;  1B8J A;  3BDF A;  3SZZ A;  1ALJ A;  3UN2 A;  1E2S P;  1ELX A;  1Y6V A;  3CMR A;  3UN5 A;  1E3C P;  1KHJ A;  1ED9 A;  3BDG A;  1AJA A;  1N2K A;  1ANJ A;  3T01 A;  1ALI A;  1O98 A;  3DYC A;  1ANI A;  1ED8 A;  3M7V A;  1ALK A;  1O99 A;  1AJB A;  2GA3 A;  1KHN A;  1FSU A;  1AJC A;  3BDG B;  3IGY B;  3T02 A;  1ZEF A;  3M8Y A;  1SHQ A;  1KH7 A;  1KHK A;  1KH5 A;  1ELY A;  1ZEB A;  1P49 A;  2G9Y A;  1E1Z P;  2ANH A;  1Y7A A;  3UO0 A;  1EW9 A;  3TX0 A;  3MK0 A;  4FDJ A;  4FDI A;  3M8Z A;  1KHL A;  1KH4 A;  3OT9 A;  3IGZ B;  3MK2 A;  1N2L A;  1HDH A;  1SHN A;  3TWZ A;  1E33 P;  1KH9 A;  1EW2 A;  3ED4 A;  1URB A;  1AJD A;  3NVL A;  1EQJ A;  3BDH A; 
#chains in the KnotProt database with same CATH topology
 1AUK A;  3T00 A;  1EI6 A;  1ZED A;  1EJJ A;  3SZY A;  3DPC A;  1URA A;  3M8W A;  2QZU A;  1HJK A;  3MK1 A;  3UN3 A;  2IFY A;  3UNY A;  2GLQ A;  1ELZ A;  1K7H A;  1HQA A;  1EW8 A;  1B8J A;  3BDF A;  3SZZ A;  1ALJ A;  3UN2 A;  1E2S P;  1ELX A;  1Y6V A;  3CMR A;  3UN5 A;  3D7S D;  1E3C P;  1KHJ A;  1ED9 A;  3BDG A;  3D7S B;  1AJA A;  1N2K A;  1ANJ A;  3T01 A;  1ALI A;  1O98 A;  3DYC A;  1ANI A;  1ED8 A;  3M7V A;  1ALK A;  1O99 A;  1AJB A;  2GA3 A;  1KHN A;  1FSU A;  1AJC A;  3BDG B;  3IGY B;  3T02 A;  1ZEF A;  3M8Y A;  1SHQ A;  1KH7 A;  1KHK A;  1KH5 A;  1ELY A;  1ZEB A;  1P49 A;  2G9Y A;  1E1Z P;  2ANH A;  1Y7A A;  3UO0 A;  1EW9 A;  3TX0 A;  3MK0 A;  4FDJ A;  4FDI A;  3M8Z A;  1KHL A;  1KH4 A;  3OT9 A;  3IGZ B;  3MK2 A;  1N2L A;  1HDH A;  1SHN A;  3TWZ A;  1E33 P;  1KH9 A;  1EW2 A;  3ED4 A;  1URB A;  1AJD A;  3NVL A;  1EQJ A;  3BDH A; 
#chains in the KnotProt database with same CATH homology
 1AUK A;  3T00 A;  1EI6 A;  1ZED A;  1EJJ A;  3SZY A;  3DPC A;  1URA A;  3M8W A;  2QZU A;  1HJK A;  3MK1 A;  3UN3 A;  2IFY A;  3UNY A;  2GLQ A;  1ELZ A;  1K7H A;  1HQA A;  1EW8 A;  1B8J A;  3BDF A;  3SZZ A;  1ALJ A;  3UN2 A;  1E2S P;  1ELX A;  1Y6V A;  3CMR A;  3UN5 A;  1E3C P;  1KHJ A;  1ED9 A;  3BDG A;  1AJA A;  1N2K A;  1ANJ A;  3T01 A;  1ALI A;  1O98 A;  3DYC A;  1ANI A;  1ED8 A;  3M7V A;  1ALK A;  1O99 A;  1AJB A;  2GA3 A;  1KHN A;  1FSU A;  1AJC A;  3BDG B;  3IGY B;  3T02 A;  1ZEF A;  3M8Y A;  1SHQ A;  1KH7 A;  1KHK A;  1KH5 A;  1ELY A;  1ZEB A;  1P49 A;  2G9Y A;  1E1Z P;  2ANH A;  1Y7A A;  3UO0 A;  1EW9 A;  3TX0 A;  3MK0 A;  4FDJ A;  4FDI A;  3M8Z A;  1KHL A;  1KH4 A;  3OT9 A;  3IGZ B;  3MK2 A;  1N2L A;  1HDH A;  1SHN A;  3TWZ A;  1E33 P;  1KH9 A;  1EW2 A;  3ED4 A;  1URB A;  1AJD A;  3NVL A;  1EQJ A;  3BDH A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling